Sequence Information:
ADAM_4005 | |
KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTKCDSGWNH | |
Phoratoxin | |
Phoradendron tomentosum | |
AC_010 | |
1JMNA | |
[C] Alpha Beta [A] 2-Layer Sandwich [T] Crambin | |
[C] Small proteins [F] Crambin-like [S] Crambin-like [F] Crambin-like |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
ADAM_4005 | |
KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTKCDSGWNH | |
Phoratoxin | |
Phoradendron tomentosum | |
AC_010 | |
1JMNA | |
[C] Alpha Beta [A] 2-Layer Sandwich [T] Crambin | |
[C] Small proteins [F] Crambin-like [S] Crambin-like [F] Crambin-like |