AMP Search Result:
Search queryPDB_ID: 2LA2A
1 hit(s)   back
ID | Description | Sequence |
ADAM_6715 | Cecropin | RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK |
![]() | ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database, containing 7,811 unique sequences and 759 structures. It provides researchers a rapid AMP search tool and allows them to browse through AMP sequence-structure relationships. For detailed information about ADAM, please refer to the HELP page.