AMP Search Result:
Search queryPDB_ID: 2KCNA
2 hit(s)   back
| ID | Description | Sequence | 
| ADAM_0212 | Pc24g00380 | AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD | 
| ADAM_2430 | Antixoidant peptide precursor | GLFTLIKGAYKNDAPTVACN | 
|  | ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships | 
ADAM is a comprehensive antimicrobial peptide (AMP) database, containing 7,811 unique sequences and 759 structures. It provides researchers a rapid AMP search tool and allows them to browse through AMP sequence-structure relationships. For detailed information about ADAM, please refer to the HELP page.