ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships

Site menu:

Home | Search | Browse Clusters | Prediction | Contacts | Help |

ADAM is a comprehensive antimicrobial peptide (AMP) database, containing 7,811 unique sequences and 759 structures. It provides researchers a rapid AMP search tool and allows them to browse through AMP sequence-structure relationships. For detailed information about ADAM, please refer to the HELP page.

AMP Search Result:

Search query
PDB_ID: 2A9HE
2 hit(s)   back

ID	Description	Sequence
ADAM_0849	Potassium channel toxin alpha-KTx 1.1; AltName: ChTX-Lq1; AltName: ChTx-a; AltName: Charybdotoxin; ChTX; Flags: Precursor	EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
ADAM_5943	Potassium channel toxin alpha-KTx 1.1; AltName: ChTX-Lq1; AltName: ChTx-a; AltName: Charybdotoxin; ChTX; Flags: Precursor	QFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

Copyright © 2014 National Taiwan Ocean University. All rights reserved.