AMP Search Result:
Search queryPDB_ID: 1YTRA
8 hit(s)   back
ID | Description | Sequence |
ADAM_0528 | Chain A, Nmr Structure Of Plantaricin A In Dpc Micelles, 20 Structures | AYSLQMGATAIKQVKKLFKKWGW |
ADAM_1632 | Chain A, Nmr Structure Of Plantaricin A In Dpc Micelles, 20 Structures | GATAIKQVKKLFKKWGW |
ADAM_4025 | Chain A, Nmr Structure Of Plantaricin A In Dpc Micelles, 20 Structures | KSSAYSLQMGATAIKQVKKLFKKWGW |
ADAM_4971 | Plantaricin A precursor peptide, induction factor | MKIQIKGMKQLSNKEMQKIVGGKSSAYSLQMGATAIKQVKKLFKKWGW |
ADAM_7748 | Chain A, Nmr Structure Of Plantaricin A In Dpc Micelles, 20 Structures | YSLQMGATAIKQVKKLFKKKGG |
ADAM_7749 | Chain A, Nmr Structure Of Plantaricin A In Dpc Micelles, 20 Structures | YSLQMGATAIKQVKKLFKKWGW |
ADAM_3803 | DNA polymerase, partial | KKLFKKILKYL |
ADAM_0287 | Lysyl-tRNA synthetase | ALYKKLFKKLLKR |