ADAM is a comprehensive antimicrobial peptide (AMP) database, containing 7,811 unique sequences and 759 structures. It provides researchers a rapid AMP search tool and allows them to browse through AMP sequence-structure relationships. For detailed information about ADAM, please refer to the HELP page.

AMP Search Result:

Search query
PDB_ID: 1BK8A
2 hit(s)   back

IDDescriptionSequence
ADAM_0400Defensin-like protein 1; AltName: Cysteine-rich antimicrobial protein 1; AltName: Defensin AMP1; AhAMP1ASHGACHKRENHWKCFCYF
ADAM_4216Defensin-like protein 1; AltName: Cysteine-rich antimicrobial protein 1; AltName: Defensin AMP1; AhAMP1LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC