ADAM is a comprehensive antimicrobial peptide (AMP) database, containing 7,811 unique sequences and 759 structures. It provides researchers a rapid AMP search tool and allows them to browse through AMP sequence-structure relationships. For detailed information about ADAM, please refer to the HELP page.

AMP Search Result:

Search query
Name: lactoferrin
5 hit(s)   back

IDDescriptionSequence
ADAM_0837Chain A, Structure Of Diferric Mare Lactoferrin At 2.62a ResolutionEDLIWK
ADAM_1094Chain A, Crystal Structure Of The Complex Of Human Lactoferrin N-Lobe And Lactoferrin-Binding Domain Of Pneumococcal Surface Protein AFFSASCVPGADKGQFPNLCRLCAGTGENKCA
ADAM_1094Chain A, Crystal Structure Of The Complex Of Human Lactoferrin N-Lobe And Lactoferrin-Binding Domain Of Pneumococcal Surface Protein AFFSASCVPGADKGQFPNLCRLCAGTGENKCA
ADAM_1094Chain A, Crystal Structure Of The Complex Of Human Lactoferrin N-Lobe And Lactoferrin-Binding Domain Of Pneumococcal Surface Protein AFFSASCVPGADKGQFPNLCRLCAGTGENKCA
ADAM_0837Chain A, Structure Of Diferric Mare Lactoferrin At 2.62a ResolutionEDLIWK