Sequence Information:
| ADAM_7789 | |
| YTSLIHSLIEETQNQQEKNEQELLELDKWASLWNWF | |
| Chain A, Structure Of The C-terminal Domain Of A Putative Hiv-1 Gp41 Fusion Intermediate | |
| Human immunodeficiency virus type 1 lw12.3 isolate | |
| AC_001 | |
| 3H00A | |
| [C] Mainly Alpha [A] Up-down Bundle [T] Single alpha-helices involved in coiled-coils or other helix-helix interfaces | |
| [C] Coiled coil proteins [F] Stalk segment of viral fusion proteins [S] Virus ectodomain [F] Virus ectodomain | |
