Sequence Information:
| ADAM_7545 | |
| WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL | |
| Chain A, Structure Of A Longer Thermalstable Core Domain Of Hiv-1 Gp41 Containing The Enfuvirtide Resistance Mutation N43d | |
| Human immunodeficiency virus 1 | |
| AC_001 | |
| 3CP1A | |
| [C] Mainly Alpha [A] Up-down Bundle [T] Single alpha-helices involved in coiled-coils or other helix-helix interfaces | |
| [C] Coiled coil proteins [F] Stalk segment of viral fusion proteins [S] Virus ectodomain [F] Virus ectodomain | |
