Sequence Information:
ADAM_7544 | |
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLE | |
Chain A, Structure Of A Longer Thermalstable Core Domain Of Hiv-1 Gp41 Containing The Enfuvirtide Resistance Mutation N43d | |
Human immunodeficiency virus 1 | |
AC_001 | |
3CP1A | |
[C] Mainly Alpha [A] Up-down Bundle [T] Single alpha-helices involved in coiled-coils or other helix-helix interfaces | |
[C] Coiled coil proteins [F] Stalk segment of viral fusion proteins [S] Virus ectodomain [F] Virus ectodomain |