Sequence Information:
| ADAM_7415 | |
| VSRRYLASLHKKALPTSVTFELLFDGTNPS | |
| envelope glycoprotein polyprotein, partial | |
| Classical swine fever virus | |
| 2YQ3A | |
| [C] NA [A] NA [T] NA | |
| [C] NA [F] NA [S] NA [F] NA | |
|  | ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships | 
ADAM is a comprehensive antimicrobial peptide (AMP) database...
| ADAM_7415 | |
| VSRRYLASLHKKALPTSVTFELLFDGTNPS | |
| envelope glycoprotein polyprotein, partial | |
| Classical swine fever virus | |
| 2YQ3A | |
| [C] NA [A] NA [T] NA | |
| [C] NA [F] NA [S] NA [F] NA | |