Sequence Information:
ADAM_7077 | |
SWLSKTYKKLENSAKKRISEGIAIAIQGGPR | |
Cecropin-P2; Flags: Precursor | |
Ascaris suum | |
2IY3A | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
ADAM_7077 | |
SWLSKTYKKLENSAKKRISEGIAIAIQGGPR | |
Cecropin-P2; Flags: Precursor | |
Ascaris suum | |
2IY3A | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |