Sequence Information:
| ADAM_6940 | |
| SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVS QRRKLLDYLKRKDVARYTQLIERLGLRR | |
| Chain O, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome | |
| Escherichia coli | |
| AC_001 | |
| 1P6GO | |
| [C] Mainly Alpha [A] Up-down Bundle [T] Single alpha-helices involved in coiled-coils or other helix-helix interfaces | |
| [C] Coiled coil proteins [F] Stalk segment of viral fusion proteins [S] Virus ectodomain [F] Virus ectodomain | |
