Sequence Information:
ADAM_6888 | |
SKLLKSTNFQRLGLSISRKNIKHAYRRNKIKRLIRELDFVVIVNIL | |
ribonuclease P | |
Buchnera aphidicola str. Sg (Schizaphis graminum) | |
2LJPA | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
ADAM_6888 | |
SKLLKSTNFQRLGLSISRKNIKHAYRRNKIKRLIRELDFVVIVNIL | |
ribonuclease P | |
Buchnera aphidicola str. Sg (Schizaphis graminum) | |
2LJPA | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |