Sequence Information:
ADAM_6458 | |
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL | |
Chain A, Crystal Structure Of The D10-p1/iqn17 Complex: A D-peptide Inhibitor Of Hiv-1 Entry Bound To The Gp41 Coiled-coil Pocket. | |
AC_001 | |
1CZQA | |
[C] Mainly Alpha [A] Up-down Bundle [T] Single alpha-helices involved in coiled-coils or other helix-helix interfaces | |
[C] Coiled coil proteins [F] Stalk segment of viral fusion proteins [S] Virus ectodomain [F] Virus ectodomain |