Sequence Information:
| ADAM_6458 | |
| RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL | |
| Chain A, Crystal Structure Of The D10-p1/iqn17 Complex: A D-peptide Inhibitor Of Hiv-1 Entry Bound To The Gp41 Coiled-coil Pocket. | |
| AC_001 | |
| 1CZQA | |
| [C] Mainly Alpha [A] Up-down Bundle [T] Single alpha-helices involved in coiled-coils or other helix-helix interfaces | |
| [C] Coiled coil proteins [F] Stalk segment of viral fusion proteins [S] Virus ectodomain [F] Virus ectodomain | |
