Sequence Information:
ADAM_5014 | |
MKLPVQQVYSVYGGKDLPKGHSHSTMPFLSKLQFLTKIYLLDIHTQPFFI | |
bacteriocin-like product | |
Bacillus subtilis subsp. subtilis str. 168 | |
3IZAA | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
ADAM_5014 | |
MKLPVQQVYSVYGGKDLPKGHSHSTMPFLSKLQFLTKIYLLDIHTQPFFI | |
bacteriocin-like product | |
Bacillus subtilis subsp. subtilis str. 168 | |
3IZAA | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |