Sequence Information:
ADAM_4426 | |
LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN LNLNNAASIPSKCNVNVPYTISPDIDCSRIY | |
Non-specific lipid-transfer protein 1; LTP 1; AltName: Full=Probable amylase/protease inhibitor; Flags: Precursor | |
Desulfohalobium retbaense DSM 5692 | |
AC_014 | |
1MIDA | |
[C] Mainly Alpha [A] Orthogonal Bundle [T] Hydrophobic Seed Protein [H] Plant lipid-transfer and hydrophobic proteins | |
[C] All alpha proteins [F] Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [S] Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [F] Plant lipid-transfer and hydrophobic proteins |