Sequence Information:
| ADAM_4174 | |
| KYYGNGLSCSKKGCTVNWGQAFSCGVNRVATAGHGK | |
| prebacteriocin 423 | |
| Lactobacillus plantarum | |
| AC_073 | |
| 1CW6A | |
| [C] [A] [T] | |
| [C] Peptides [F] Leucocin-like bacteriocin [S] Leucocin-like bacteriocin [F] Leucocin-like bacteriocin | |
|  | ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships | 
ADAM is a comprehensive antimicrobial peptide (AMP) database...
| ADAM_4174 | |
| KYYGNGLSCSKKGCTVNWGQAFSCGVNRVATAGHGK | |
| prebacteriocin 423 | |
| Lactobacillus plantarum | |
| AC_073 | |
| 1CW6A | |
| [C] [A] [T] | |
| [C] Peptides [F] Leucocin-like bacteriocin [S] Leucocin-like bacteriocin [F] Leucocin-like bacteriocin | |