Sequence Information:
ADAM_2947 | |
GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN | |
Cyclotide Hyfl-B | |
Hybanthus floribundus | |
AC_005 | |
2GJ0A | |
[C] [A] [T] | |
[C] Small proteins [F] Knottins (small inhibitors, toxins, lectins) [S] Cyclotides [F] Kalata B1 |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
ADAM_2947 | |
GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN | |
Cyclotide Hyfl-B | |
Hybanthus floribundus | |
AC_005 | |
2GJ0A | |
[C] [A] [T] | |
[C] Small proteins [F] Knottins (small inhibitors, toxins, lectins) [S] Cyclotides [F] Kalata B1 |