Sequence Information:
| ADAM_0758 | |
| DPLVFPSDEFDASISQVNEKINQSLAFIRKSDELL | |
| Chain A, Structural Basis For Immunization With Post-Fusion Rsv F To Elicit High Neutralizing Antibody Titers | |
| Human respiratory syncytial virus | |
| AC_001 | |
| 1G2CB | |
| [C] Mainly Alpha [A] Up-down Bundle [T] Single alpha-helices involved in coiled-coils or other helix-helix interfaces | |
| [C] Coiled coil proteins [F] Stalk segment of viral fusion proteins [S] Virus ectodomain [F] Virus ectodomain | |
