Sequence Information:
ADAM_0705 | |
DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR | |
sperm-associated antigen 11 precursor | |
synthetic construct | |
4DMGA | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
ADAM_0705 | |
DIPPGIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR | |
sperm-associated antigen 11 precursor | |
synthetic construct | |
4DMGA | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |