Sequence Information:
ADAM_0681 | |
DFYKRFVPNCNYKFSLANCFGKERYMNWRSPDAVYHLAK | |
OGC-RA2 antimocrobial peptide precursor | |
Odorrana andersonii | |
3C5CA | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
ADAM_0681 | |
DFYKRFVPNCNYKFSLANCFGKERYMNWRSPDAVYHLAK | |
OGC-RA2 antimocrobial peptide precursor | |
Odorrana andersonii | |
3C5CA | |
[C] NA [A] NA [T] NA | |
[C] NA [F] NA [S] NA [F] NA |