 | ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database, containing 7,811 unique sequences and 759 structures. It provides researchers a rapid AMP search tool and allows them to browse through AMP sequence-structure relationships. For detailed information about ADAM, please refer to the HELP page.
| ID | Description | Sequence |
| ADAM_7004 | Chromogranin A | SSMKLSFRARAYGFRGPGPQL |
| ADAM_4426 | Non-specific lipid-transfer protein 1; LTP 1; AltName: Probable amylase/protease inhibitor; Flags: Precursor | LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN LNLNNAASIPSKCNVNVPYTISPDIDCSRIY |