 | ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database, containing 7,811 unique sequences and 759 structures. It provides researchers a rapid AMP search tool and allows them to browse through AMP sequence-structure relationships. For detailed information about ADAM, please refer to the HELP page.
| ID | Description | Sequence |
| ADAM_0909 | Chain A, Solution Structure Of Antifungal Peptide, Scarabaecin | ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS |
| ADAM_5092 | Scarabaecin; Contains: Scarabaecin, minor form; Contains: Scarabaecin, major form; Flags: Precursor | MKTLTFYTLLLCAALYSNFFDCKAVADAELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSP FAFSKK |