Sequence Information:
ADAM_7765 | |
YTSLIHSLIEEIQNQQEKNEQELLELDKWASLWNWF | |
Chain A, Structure Of The C-terminal Domain Of A Putative Hiv-1 Gp41 Fusion Intermediate | |
Human immunodeficiency virus type 1 lw12.3 isolate | |
AC_001 | |
3H00A | |
[C] Mainly Alpha [A] Up-down Bundle [T] Single alpha-helices involved in coiled-coils or other helix-helix interfaces | |
[C] Coiled coil proteins [F] Stalk segment of viral fusion proteins [S] Virus ectodomain [F] Virus ectodomain |