Sequence Information:
| ADAM_7203 | |
| TTLTLHNLCPYPVWWLVTPNNGGFPIIDNTPVVLG | |
| TPA: putative thaumatin domain family protein | |
| Escherichia coli | |
| 3KQXA | |
| [C] NA [A] NA [T] NA | |
| [C] NA [F] NA [S] NA [F] NA | |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
| ADAM_7203 | |
| TTLTLHNLCPYPVWWLVTPNNGGFPIIDNTPVVLG | |
| TPA: putative thaumatin domain family protein | |
| Escherichia coli | |
| 3KQXA | |
| [C] NA [A] NA [T] NA | |
| [C] NA [F] NA [S] NA [F] NA | |