Sequence Information:
ADAM_4175 | |
KYYGNGLSCSKKGCTVNWGQAFSCGVNRVATAGHHKC | |
prebacteriocin 423 | |
Lactobacillus plantarum | |
AC_073 | |
1CW6A | |
[C] [A] [T] | |
[C] Peptides [F] Leucocin-like bacteriocin [S] Leucocin-like bacteriocin [F] Leucocin-like bacteriocin |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
ADAM_4175 | |
KYYGNGLSCSKKGCTVNWGQAFSCGVNRVATAGHHKC | |
prebacteriocin 423 | |
Lactobacillus plantarum | |
AC_073 | |
1CW6A | |
[C] [A] [T] | |
[C] Peptides [F] Leucocin-like bacteriocin [S] Leucocin-like bacteriocin [F] Leucocin-like bacteriocin |