Sequence Information:
| ADAM_3762 | |
| KICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVN | |
| thionin 2.1 | |
| Arabidopsis thaliana | |
| AC_010 | |
| 1ORLA | |
| [C] Alpha Beta [A] 2-Layer Sandwich [T] Crambin | |
| [C] Small proteins [F] Crambin-like [S] Crambin-like [F] Crambin-like | |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
| ADAM_3762 | |
| KICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVN | |
| thionin 2.1 | |
| Arabidopsis thaliana | |
| AC_010 | |
| 1ORLA | |
| [C] Alpha Beta [A] 2-Layer Sandwich [T] Crambin | |
| [C] Small proteins [F] Crambin-like [S] Crambin-like [F] Crambin-like | |