Sequence Information:
| ADAM_2688 | |
| GLPVCGETCFGGTCNTPGCSCDPWPMCSRN | |
| Kalata-B1; Flags: Precursor | |
| Oldenlandia affinis | |
| AC_005 | |
| 2KHBA | |
| [C] [A] [T] | |
| [C] Small proteins [F] Knottins (small inhibitors, toxins, lectins) [S] Cyclotides [F] Kalata B1 | |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
| ADAM_2688 | |
| GLPVCGETCFGGTCNTPGCSCDPWPMCSRN | |
| Kalata-B1; Flags: Precursor | |
| Oldenlandia affinis | |
| AC_005 | |
| 2KHBA | |
| [C] [A] [T] | |
| [C] Small proteins [F] Knottins (small inhibitors, toxins, lectins) [S] Cyclotides [F] Kalata B1 | |