Sequence Information:
| ADAM_0198 | |
| AKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW | |
| 30S ribosomal protein S14 | |
| Bacillus subtilis subsp. subtilis str. 168 | |
| 1I94N | |
| [C] NA [A] NA [T] NA | |
| [C] NA [F] NA [S] NA [F] NA | |
![]() |
ADAM: A Database of Anti-Microbial peptides A comprehensive antimicrobial peptide database with sequence-structure relationships |
ADAM is a comprehensive antimicrobial peptide (AMP) database...
| ADAM_0198 | |
| AKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW | |
| 30S ribosomal protein S14 | |
| Bacillus subtilis subsp. subtilis str. 168 | |
| 1I94N | |
| [C] NA [A] NA [T] NA | |
| [C] NA [F] NA [S] NA [F] NA | |